PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA014631-PA
Common NameOsI_16822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 739aa    MW: 80052 Da    PI: 6.6926
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA014631-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.21.6e-3199183187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+++e+laLi++r+em+ ++r++ lk+plWeevs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f++lea
  BGIOSGA014631-PA  99 RWPREETLALIRIRSEMDATFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YRFFTELEA 183
                       8*********************************************************************866665..******985 PP

2trihelix107.87.3e-34491575186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k ev+aLi++r e++ r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+
  BGIOSGA014631-PA 491 RWPKTEVQALIQLRMELDMRYQETGPKGPLWEEISSGMRRLGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLD 575
                       8*********************************************************************8.99**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.18992156IPR017877Myb-like domain
SMARTSM007172.1E-496158IPR001005SANT/Myb domain
PfamPF138373.4E-2298184No hitNo description
CDDcd122035.71E-3098163No hitNo description
PROSITE profilePS500907.805484548IPR017877Myb-like domain
SMARTSM007178.3E-6488550IPR001005SANT/Myb domain
PfamPF138376.8E-23490576No hitNo description
Gene3DG3DSA:1.10.10.603.8E-4490547IPR009057Homeodomain-like
CDDcd122032.80E-29491555No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MQQHQGGGSQ YGAVPPDMGP FSPTHHASAP APLPLSSRPP PAALSQPPPP QQQQQQPRTS  60
YDELAAATSA GAGGFPDDDM LGDAGGSGGG GGSGAAGNRW PREETLALIR IRSEMDATFR  120
DATLKGPLWE EVSRKLAELG YKRSAKKCKE KFENVHKYYK RTKEGRAGRQ DGKSYRFFTE  180
LEALHAAAPQ TPQPQQQQQQ QLPPVTSSAP AMHAFAPPVP APPPMSAMPP PPGPIQPAPI  240
SSAAPAVPLE LPPQPPINLQ GLSFSSMSGS ESDDESEDDE MTAETGGSQD RLGKRKRGAG  300
GKRLATFFEG LIKQVVDRQE EMQRRFLETM EKREAERTAR EEAWRRQEVA RLNREQEQLA  360
QERAAAASRD AAIISFLQRI GGQSVQVPPA ATVIQMPTPV QLQTPPPVKQ PARQHQPQPT  420
PPPPQAAPIP AAPLQQQPPQ PQHKETIHHE AVTPRRAPPT SGSSLELVPA AEQHVESGLG  480
GGEGGSASSS RWPKTEVQAL IQLRMELDMR YQETGPKGPL WEEISSGMRR LGYNRSSKRC  540
KEKWENINKY FKKVKESNKK RPEDSKTCPY FHQLDVIYRR KHLTGGGGGG ASAANVAATA  600
IEHQNPNRHE IEGKNINDND KRKNGGGGGA QVPTSNGDTA PTTATFDVDS GMKKPEDIVR  660
ELSEQPPREF TTDETDSDDM GDDYTDDGEE GEDDGKMQYR IQFQRPNPGG ANTAPPPATT  720
PASAVPTSTP TSTFLAMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149KRSAKKCKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.823130.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329923480.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX682610.0X68261.1 O.sativa gt-2 gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637050.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
TrEMBLA0A0E0PC570.0A0A0E0PC57_ORYRU; Uncharacterized protein
TrEMBLB8ASL50.0B8ASL5_ORYSI; Putative uncharacterized protein
TrEMBLQ01IP40.0Q01IP4_ORYSA; H0115B09.8 protein
TrEMBLQ7XR860.0Q7XR86_ORYSJ;
STRINGBGIOSGA014631-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.18e-48Trihelix family protein